"actions" : [ "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "context" : "", "kudosLinksDisabled" : "false", { Das Problem ist jetzt, dass ich eine neue IP habe und es kompliziert wird alle Einträge aller Webseiten zu ändern. }, "actions" : [ }, { "context" : "", "actions" : [ "action" : "rerender" LITHIUM.Dialog({ { { if ( neededkeys[count] == key ) { { ] ], "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetAnswerForm", }); "context" : "", "event" : "AcceptSolutionAction", "displaySubject" : "true", ] "actions" : [ { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); ] element.find('ul').slideUp(); Bist du sicher, dass du fortfahren möchtest? count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); }, ] ;(function($){ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); { resetMenu(); }, }, ] "actions" : [ "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I8ypReJJEj5FGq7W4vw_S70RifBHjZGVEjJnkbthDh4. "event" : "expandMessage", { "action" : "rerender" oder du stellst dein Heimnetz auf IPV6 um, die Hersteller hams alle verpennt, ihre Hardware IPV6 tauglich zu machen! ] }, "parameters" : { $(document).ready(function(){ "event" : "addThreadUserEmailSubscription", if ( count == neededkeys.length ) { "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ } ] $('.js-close-header-announcement').on('click', clickHandler); :). { "disableLabelLinks" : "false", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] { "context" : "", "activecastFullscreen" : false, "disableKudosForAnonUser" : "false", } "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "", ] ] var keycodes = { Neustart des Routers, welche IP-Adresse wird geändert? { { $('#vodafone-community-header .lia-search-input-wrapper').hide(); ] if ( key == neededkeys[0] ) { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); IP ändert sich nicht nach Router neustart. "revokeMode" : "true", "kudosable" : "true", } "includeRepliesModerationState" : "false", { { "linkDisabled" : "false" ] } .attr('aria-expanded','true'); Nun meine Frage. LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "lia-deleted-state", "kudosLinksDisabled" : "false", ] }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] "context" : "", } { "event" : "ProductAnswer", "truncateBody" : "true", ], LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ], }, } "componentId" : "forums.widget.message-view", }, "action" : "pulsate" ] Wenn ich den Router manuell über die Benutzeroberfläche neustarte erhalte ich dann eine neue IP? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { }, "truncateBodyRetainsHtml" : "false", watching = false; { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'rbezfimvXikNQlPjtWHFO5XXX8DQ5Oh8S_5cXnLId00. { Analoges Telefon: Stecken Sie den Stecker in den Anschluss TEL1 oder LINE1 Ihres Kabel-Routers: Hinweis: Der Anschluss LINE2 ist nicht aktiv. "quiltName" : "ForumMessage", "action" : "rerender" "disableLabelLinks" : "false", "event" : "ProductAnswerComment", $(this).next().toggle(); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", }, { } ] ] } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234532}); "event" : "unapproveMessage", "event" : "markAsSpamWithoutRedirect", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { event.preventDefault(); }, "revokeMode" : "true", ] { ] "event" : "removeThreadUserEmailSubscription", "actions" : [ "parameters" : { "actions" : [ "event" : "ProductAnswerComment", Falls Du allerdings eine statische IP von Deinem Provider bekommst, lässt sich diese nicht ändern. Tragen Sie in den Eingabefeldern die Zugangsdaten ein, die im Willkommensbrief von Vodafone im Abschnitt "Ihr Internetzugang (nur für Expertenmodus bei manueller Konfiguration)" aufgeführt sind. }, "selector" : "#kudosButtonV2_0", LITHIUM.AjaxSupport.ComponentEvents.set({ "useSimpleView" : "false", } }, ] "event" : "addThreadUserEmailSubscription", { ] "action" : "rerender" ] "includeRepliesModerationState" : "false", ] "defaultAriaLabel" : "", // Oops. CookieManager = { "actions" : [ "action" : "rerender" "triggerEvent" : "click", { }, }, "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName,message", "actions" : [ "context" : "", $(this).toggleClass('active'); LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); LITHIUM.Dialog({ } { Dieses Autsch hab ich schon mal gesehen, ist immer wieder schön. ] "action" : "rerender" ] $(document).ready(function(){ } }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); } "context" : "", "event" : "approveMessage", }, "accessibility" : false, "context" : "envParam:selectedMessage", // We're good so far. LITHIUM.Dialog.options['537737561'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "revokeMode" : "true", "displayStyle" : "horizontal", { } // --> "action" : "rerender" } .attr('aria-hidden','true') // Set start to true only if the first key in the sequence is pressed }, "action" : "rerender" "actions" : [ "action" : "rerender" LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "action" : "addClassName" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } $('.css-menu').removeClass('cssmenu-open') "actions" : [ "useSubjectIcons" : "true", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1691725,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductMessageEdit", { Heißt das, das ich eine feste IP hab oderso? "action" : "rerender" } { "initiatorBinding" : true, $(this).toggleClass('active'); "defaultAriaLabel" : "", "}); "quiltName" : "ForumMessage", "event" : "RevokeSolutionAction", { "actions" : [ "action" : "rerender" { }, }; { // Set start to true only if the first key in the sequence is pressed }, }, "disableLinks" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } ] { { } var watching = false; "actions" : [ "action" : "rerender" ] }, //if(height > 430) { "actions" : [ ] $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "event" : "removeMessageUserEmailSubscription", }, } "action" : "rerender" { "displayStyle" : "horizontal", LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; window.location = "https://forum.vodafone.de/t5/Archiv-Internet-Ger%C3%A4te/IPv4-aktivieren/td-p/1691725" + "/page/" + 1;

Paw Patrol Bastelvorlagen Kostenlos, Porsche 997 Kaufberatung, Bordeaux Dogge Wegen Zeitmangel, Stahl Getränke Angebote, Antrag Auf Beschulung Außerhalb Des Einzugsgebietes Begründung, Rolf Schult Hörprobe,